SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_072_00007.1|PACid:22041340 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_072_00007.1|PACid:22041340
Domain Number 1 Region: 383-629
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.61e-66
Family Extended AAA-ATPase domain 0.000000177
Further Details:      
 
Domain Number 2 Region: 643-838
Classification Level Classification E-value
Superfamily FtsH protease domain-like 1.06e-41
Family FtsH protease domain-like 0.000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_072_00007.1|PACid:22041340
Sequence length 865
Sequence
RSRFHRSNSFLSLQFQSLHLLSSSLYLSISPSFLLQSILSEFSFGMSGIESLQRIAHRKI
SASFKCNVSARTRNFNFPLKSDRFGVNFRSLSSNNVYKLASLSKTIDGFDVKRGYLKDQR
LREYRIRASSCEQDSDSKASSSNDKSEGKVNESKDVSNTSSSSSSSTSPSSPRREKHGKG
GWWKGGKWQWQPIVQAQEIGILLLQLGIVMFVMRLLRPGIPLPGSEPRTPATFISVPYSD
FLTKVNNNQVQKVEVDGVHIMFKLKSEPAIIEQEADSLIRSQETEALVKSVTPTKRIIFT
TTRPSDLKAPYEKMVENDVEFGSPDKRSGGFWNSALIAIFYCAVLAGLLLRFEVSFSQHT
PGQLRSRKSGSSGGAKASEQGETIMFSDVAGVDEAKEELQEIVEFLKNPDRYVRLGARPP
RGVLLVGLPGTGKTLLAKAVAGEAEVPFISCSASEFVELYVGMGASRVRDLFAKAKKEAP
SIIFIDEIDAVAKSRDGKFRMVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATNRADVLD
PALRRPGRFDRVVTVEAPDRVGREAILKVHATKKELPLGDDVDLGAIASMTTGFTGADLA
NLVNEAALLAGRLNKVVVEKFDFIQAVERSIAGIEKKHTKLQGSEKAVVARHEAGHAVVG
TAVGNLISGQPRVEKLSILPRSGGALGFTYTPPTTEDRYLLFIDELRGRLVTLLGGRAAE
EVVYSGRVSTGALDDIRRATDMAYKAIAEYGLNDTIGPLSLATLSGGGLDESGGGSPWGR
DQGHLVDLVQREVKELLQSALEVAISVVRANPTVLEGLGAHLEENEKVEGEELHEWLKLV
VAPAELAIFISGKQESLLPLQVTTL
Download sequence
Identical sequences A0A2G5C9Y7
Aquca_072_00007.1|PACid:22041340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]