SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_072_00038.1|PACid:22041360 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_072_00038.1|PACid:22041360
Domain Number - Region: 93-139
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 0.0432
Family Substrate-binding domain of HMG-CoA reductase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_072_00038.1|PACid:22041360
Sequence length 664
Sequence
MTNMEEPTENKEIEKFEEHREQLGSEWKEIPPWTKQITVRGLVASFVIGGLYSVVIMKLN
LTTGLVPNLNVSAALVAFVFIRSWTKVLQKAGVVSVPFTRQENSVIQTCTVACYAIANGG
GFGSYLLGLNKKTYEQAGVNTKGNTPGSYKEPGFAWMTGFLFVTCFVGLLALVPLRKILI
IDYKLTYPSGTASGILINGFHSSQTDKNAKKQVRGFTKFFGISFLWGFFEWFFSGGEECG
FGEFPTFGLKAWKQTFYFNFNMTYVGAGMICPHLVNLSLLFGAVISWGLMWPLIHGRKGD
WYPADIPESSMNSLQGYKVFISIALLLGDGLYNFLKILASTSKNIHARLNNKPVSTVGDS
PNQNYDDLYKNQVFLKDKIPAWVSFAGYTFFSIIAIIVIPYMFPELKWYYVLVAYMLAPS
LGFCNAYGAGLTDINMAYNYGKVALFVLAALAGKEHGVVAGLIGCGLIKSIVSISSDLMH
DFKTGHITHTSPRSMLVSQAVGTAMGCIIAPLTFLLYYKAFDVGNPDGVFKAPYAIIYRN
IAIIAVEGFSTLPQHCLQLCYGFFIFAVIANLLRDFSPRKIGKWIPLPMAMAVPFLVGAY
FAIDMCLGSLIVFVWGKLNSKKASVMVPAVASGLICGDGLWTLPASILALAKVTPPICMK
FLAA
Download sequence
Identical sequences A0A2G5CB80
Aquca_072_00038.1|PACid:22041360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]