SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_072_00055.1|PACid:22041265 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_072_00055.1|PACid:22041265
Domain Number 1 Region: 179-463
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.14e-76
Family WD40-repeat 0.00018
Further Details:      
 
Weak hits

Sequence:  Aquca_072_00055.1|PACid:22041265
Domain Number - Region: 8-99
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000217
Family beta-sandwich domain of Sec23/24 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_072_00055.1|PACid:22041265
Sequence length 775
Sequence
MMYADQQQQIQQQHLQQQQHPQQQQQQQHHQQQQYQQHQQHQQQQQQHQQQQQQQMMQQQ
QQQHQGFDFHRGPPPMRQPSASSTNLNPDYHPAGPPPPYDAHGDSFAAKRIRKVVHRKAV
DYTSTVVRYMQIRMWQRDSRDRTVLQPTPAAAIDMLPTIAYADNPSTSFAAKFVHASTNK
NRCPINRVLWTPTGRRLITGSQSGEFTLWNGQSFNFEMILQAHDQPIRSMVWSHNENWMV
SGDDGGSIKYWQNNMNNVKANKTAHKESVRDLSFCRTNLKFCSCSDDTTVKVWDFARCQE
ERSLSGHGWDVKSVDWHPTKSLLVSGGKDNLVKLWDAKTGRELSSFHGHKNTVLSVKWNQ
NGNWVLTASKDQIIKLYDIRMMKELESFRGHQKDVTALAWHPFHEEYFVSGSYDGSIFHW
LVGHENPQVEVCGAHENSVWDLAWHPIGYILCSGSNDHTTKFWCRNRPGDTSRDRFNTGF
TQGCYGEQNPAFAGRATNFPMPDGPPTPGPFSSGLPRNDGTIPGIGAAMPLSVPGLDSSD
HGDQKQPLPAPPLPPGPHPSMLASGQQAYQQFPHQIPPHQHHQAFPQHMSSLPLPPNLPH
LQPPPHISLLPHQNFPRPPPTQLGPGMPPTLPSSMPGSMPSSMGTSMPLQMPGPMGMQGS
LNQMGPPLQQGHLMGMNPMHSSSVPNNGLQPPSGGFANGMSHTQAPPNASGLQMYPPGGA
YNRPQTGQFPLGPGLNSYQAGSPGGTGMGPLGPNMGHPSNLPPPPPLPSHGSMPQ
Download sequence
Identical sequences A0A2G5CA28
Aquca_072_00055.1|PACid:22041265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]