SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_072_00055.2|PACid:22041266 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_072_00055.2|PACid:22041266
Domain Number 1 Region: 179-463
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.33e-76
Family WD40-repeat 0.00018
Further Details:      
 
Weak hits

Sequence:  Aquca_072_00055.2|PACid:22041266
Domain Number - Region: 8-99
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000217
Family beta-sandwich domain of Sec23/24 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_072_00055.2|PACid:22041266
Sequence length 774
Sequence
MMYADQQQQIQQQHLQQQQHPQQQQQQQHHQQQQYQQHQQHQQQQQQHQQQQQQQMMQQQ
QQQHQGFDFHRGPPPMRQPSASSTNLNPDYHPAGPPPPYDAHGDSFAAKRIRKVVHRKAV
DYTSTVVRYMQIRMWQRDSRDRTVLQPTPAAAIDMLPTIAYADNPSTSFAAKFVHASTNK
NRCPINRVLWTPTGRRLITGSQSGEFTLWNGQSFNFEMILQAHDQPIRSMVWSHNENWMV
SGDDGGSIKYWQNNMNNVKANKTAHKESVRDLSFCRTNLKFCSCSDDTTVKVWDFARCQE
ERSLSGHGWDVKSVDWHPTKSLLVSGGKDNLVKLWDAKTGRELSSFHGHKNTVLSVKWNQ
NGNWVLTASKDQIIKLYDIRMMKELESFRGHQKDVTALAWHPFHEEYFVSGSYDGSIFHW
LVGHENPQVEVCGAHENSVWDLAWHPIGYILCSGSNDHTTKFWCRNRPGDTSRDRFNTGF
TQGYGEQNPAFAGRATNFPMPDGPPTPGPFSSGLPRNDGTIPGIGAAMPLSVPGLDSSDH
GDQKQPLPAPPLPPGPHPSMLASGQQAYQQFPHQIPPHQHHQAFPQHMSSLPLPPNLPHL
QPPPHISLLPHQNFPRPPPTQLGPGMPPTLPSSMPGSMPSSMGTSMPLQMPGPMGMQGSL
NQMGPPLQQGHLMGMNPMHSSSVPNNGLQPPSGGFANGMSHTQAPPNASGLQMYPPGGAY
NRPQTGQFPLGPGLNSYQAGSPGGTGMGPLGPNMGHPSNLPPPPPLPSHGSMPQ
Download sequence
Identical sequences A0A2G5CA53
Aquca_072_00055.2|PACid:22041266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]