SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_072_00073.1|PACid:22041324 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_072_00073.1|PACid:22041324
Domain Number 1 Region: 19-139
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-47
Family Dcp1 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_072_00073.1|PACid:22041324
Sequence length 361
Sequence
MSPNVKLLPNLDQESTKVLNLTVLQRIDPFIEEILITAAHVTLYDFSIERSEWSRKDVEG
SLFVVKRNTQPRFQFIVMNRRNTDNLVENLLGDFEYEIQTPYLLYRNASQDVNGIWFYNT
SDCEDVANLFSRILNAYSKVSPKPKVPLTKSDIEELEDVAVMEGPLKPPASTTSIITNSQ
QDVPFVNIFSAATSTGNTSYMINAGQTHQPPAVIPPSSQSPNFLYSPRPVMQSLSTLSIS
SAQSLPPLDISHMGVSNHATNLVNPSTFLIPPSSSAVLMPPTPSSMPTAAPPHPLVSPQR
PYGAPVLQPFPPPTPPLSLTPITSTNGPIITRDKVRDMLMRLVQNHQFIDMFYEEFSKGI
N
Download sequence
Identical sequences A0A2G5CA65
Aquca_072_00073.1|PACid:22041324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]