SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_074_00035.1|PACid:22063871 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_074_00035.1|PACid:22063871
Domain Number 1 Region: 28-496
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.37e-75
Family Quinoprotein alcohol dehydrogenase-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_074_00035.1|PACid:22063871
Sequence length 531
Sequence
MALTRSGNNNGMITLFTVLYLLTIVANAGAAWLNHGGDLSNRRYAPTELVINRLSVSRLR
LKWSFYAGKDITATPAIFGGKVYFPSWNGHIYAVNALDGSLAWDKNLGELTNLTSTGVVV
NVTVSRATPTITGNLLIVGIYGPAVVIALNRFTGDLVWKTQLDNRFRALITMSGTELNGY
FYVGVSSLEEGLSPAQCCTFRGSMVKLNARTGALVWQTYTVPDNGGKLGGYSGAAIWGSS
PSIDTRRNLVYVTTGNLYTAPPEVLKCQDEQNNQTVPTHPDRCIQPDTHFNSILAFDTET
GKIRWSRQLGGYDVWYFGCLTPSSPNCPPGPNIDADFGESPMLLSIIVNGTARDAVVAVQ
KSGYAWALDSTNGDIIWSTVAGPGGTEGGGTWGASTDGRRVYTNIVNNNRVSFQLAPTNQ
TTNAGAWVALDANTGKIIWSTSNPSNDTSNGPVTLVNNVLFAGSVAPHGPIYAMDAQTGN
ILWSFDTGATVYGGVSTSYGCIFLGNGYTVGLAKFKPTWTPGTSLHAFCFL
Download sequence
Identical sequences A0A2G5C9I7
Aquca_074_00035.1|PACid:22063871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]