SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_074_00081.1|PACid:22063891 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_074_00081.1|PACid:22063891
Domain Number 1 Region: 465-565,808-937
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000152
Family WD40-repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_074_00081.1|PACid:22063891
Sequence length 945
Sequence
MGFLIRFDVSQQATGIVCATNGNFIGGKSQEIVVARGKFLYLLRPDENGKLQTILSVEVS
GRIVILEYNKEKMYLIKSIKRLLGSQKLVYVLNRDSTARLTISSPLEAHKSHTIVYSIAG
VDCGFDNPIFASIELDYLEADQDSTGQSANEAQKHLTFYELDLGLNHVSRKWSEPIDNGA
NMLVIVPGGGDGPSGILVCAENFVIYKNQGHPDVRAVIPRRADLPAERGVLIVSVATHRH
RATFFVLLQTEYGDVFKCTLEHDNDRVTELKIKYFDTIPVTISMCVLKTGFLFAASEFGN
HALYQFRAIGEEADVESSSSTLMETEEDFQPVFFQPRGLKNLIRIDQVDSLMPIMDMKVA
NLFEEETPQIFTLCGRGPRSSLRILRPGLAVSEMVVSQLPGIPIAVWTVKKNINDDATLV
LSIGETVEEVSDSGFLDTTPSLAVSLLGDDSLMQVHPKGIRHIREDGRIIQWETPGKRTI
VKVATNRVQVVIALSEGELVYFEMDITGQLMEVEKHEMSGDVACLDIALVPEGRQRSRFL
VVGSYDNTICILSLDPDDCMQVLSLQSVSSPPESLLLLEVQASVGGEDGTDHPASVFLNA
GLQNGVLFRTVVDMVTGQLSDTRSRFLGLRAPKLFSAVVRGRRAMLCLSSRPWLGYIHQG
HFLLTPLSYETLEYAASFSSDQCAEGVVAVAGDALRVFTIERLGETFNETVIPLRYTPRK
FVLHPKRKLLIVIESDQGAFTAEEREAARKECLEAAGMEENGNGNIDEMENGPDNEENDP
LSDEQYGYPKAEAEKWVSCIRVFEPRTTTTTCLLELQDNEAAFSVCTVNFSDKEYGTLLA
VGTAKSLKFWPKRSFAAGFIHIYRFIEDGKGLQLLHKTQVEGIPLALCQFQGKLLAGIGS
VLRLYDLGKRKLLRKCENKLFPNTIISLHTYRDRIYVGDIQEGCS
Download sequence
Identical sequences A0A2G5C9N2
Aquca_074_00081.1|PACid:22063891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]