SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_074_00097.3|PACid:22063909 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_074_00097.3|PACid:22063909
Domain Number 1 Region: 320-399,485-566,656-822,880-988
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 2.22e-49
Family Histidine acid phosphatase 0.012
Further Details:      
 
Domain Number 2 Region: 106-297
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 0.0000000109
Family Lysine biosynthesis enzyme LysX ATP-binding domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_074_00097.3|PACid:22063909
Sequence length 1055
Sequence
MDFEEEEQNVGNKIKIGVCVMEKKAFSAPMEEILDRLQSFGEFQIIFFGDKVILEDPIES
WPICDCLIAFHSSGYPLEKAEAYAALRKPFVVNELAQQHLLHDRRKVYERLEMYGIPVPS
YALVNRATPYQELDYFVEQEDFVEVHGKRFWKPFVEKPIHADDHRIMIYYPSSAGGGMKE
LFRKVGNRSSEFHPEVRRVRREGSYIYEEFMPTGGTDVKVYTVGPEYAHAEARKSPVVDG
VVMRNPDGKEVRYPVLLTPSEKQMARDVCIAFRQLVCGFDLLRCEGRSYVCDVNGWSFVK
NSHKYYDDAACVLRKMFLDAKAPHLSSTIPPTLPWKVNEPVQPSEGLTRQGSGIIGTFGQ
SEELRCVIAIVRHGDRTPKQKVKLKVTEEKLLNLMLKYNGGRPRSETKLKSAVQLQDLLD
ATRMLVPRTRSGRESDSDAEDLEHAEKLRQVKAVLEEGGHFSGIYRKVQLKPLKWVKVSK
SNVESDEERPIEALMVLKYGGVLTHAGRKQAEELGRYFRNNMYPGEGTGLLRLHSTYRHD
LKIYSSDEGRVQMSAAAFAKGLLDLEGQLTPILVSLVSKDSSMLDGLDNASTEMEEAKAR
LNEIITSNAKKLHTNGSSEFPWMADGAGLPSNASELLRTLVKLTKKVTAQVELLAKDEDE
KLAKTIPYAVLPPYDQATALGKTNIDVDRIAAGLPCGSEGFLLMYARWKKLERDLYNERK
ERFDITQIPDVYDSCKYDLLHNAHLNLDGLDELFKVAQLLADGVIPNEYGINPQQKLKIG
SKIARRLLGKILIDLRNTREEAITVAELKSNQDQNSVSFRTRREDSDHQLLKPQNKNEDA
RRTSSTSEMSLDQDDDDDKETKYRLDPKYAANVRTPERHVRTRLYFTSESHIHSLMNVLR
YCNLDESQQGEDSLICHSALERLSKTRELDYMSYIVLRMFENTEVALEDPKRYRIEMTFS
RGADLSPLENNDGEAASLHQEHTLPIMGPERLQEVGSYLTLETMEKMIRPFAMPAEDFPP
PTIPQGFSGYFRSAGVLERLVNLWPFHKHANANGK
Download sequence
Identical sequences A0A2G5C9T2
Aquca_074_00097.3|PACid:22063909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]