SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_075_00028.4|PACid:22039245 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_075_00028.4|PACid:22039245
Domain Number 1 Region: 353-571
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.47e-37
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0016
Further Details:      
 
Domain Number 2 Region: 285-359
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000476
Family Domains B1 and B5 of PheRS-beta, PheT 0.018
Further Details:      
 
Domain Number 3 Region: 6-72
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000696
Family Domains B1 and B5 of PheRS-beta, PheT 0.0057
Further Details:      
 
Weak hits

Sequence:  Aquca_075_00028.4|PACid:22039245
Domain Number - Region: 198-238
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000602
Family B3/B4 domain of PheRS, PheT 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_075_00028.4|PACid:22039245
Sequence length 574
Sequence
MPKVSVGRDRLFEALGKEYNLCFEFGLELDDVATEEDEVIYKVEVAANRYDLLCFEGLVR
ALRIFKELDQIPKYSVFDIPRESMLKIHVKPETALVRPYVVSAVLRDITFDQASYKSFID
LQDMLHQNICRGRTLVAIGTHDLDTIQGPFTYEALPPTEINFVPLKQVKSFRGDELMKFY
ESDMKLKKFLHIIEKSPVFPVIYDCNRTVLSLPPIINGAHSAISVHTKNVFIECTATDLT
KAKIVLNTMVTMFSVYCKRKFEVEPVEVISSDGHSCVYPDLSAYNMEVPLSKITGRIGVS
ADANQVISLLNRMQLLAEKSVLSGDLCSIIVSVPPTRSDVLEACDVAEDFAIAYGFDNIL
AQVSSSTQGGGEQSLSQISNLIRLEFAMCGFTEVLTWILCSYKDITSMLNKKDNNSTSVK
ISNPRSADFEVSRTTLMPGLLKTVRENNHHPKPIKIFEVGDVVLLNEMNDVGARNRHHLA
ALFCDDHSGFEVIHGLVQRIMEVMDIPCDSDSGYCIKDSDGVEEGEFLPGSKGSIIHKGE
SVGSFGIVHPEVLGNFKISFPCSYMEIDLQCFFN
Download sequence
Identical sequences A0A2G5C973
Aquca_075_00028.4|PACid:22039245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]