SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_075_00040.2|PACid:22039276 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_075_00040.2|PACid:22039276
Domain Number 1 Region: 554-634
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.82e-23
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  Aquca_075_00040.2|PACid:22039276
Domain Number - Region: 410-479
Classification Level Classification E-value
Superfamily PH domain-like 0.00102
Family Phosphotyrosine-binding domain (PTB) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_075_00040.2|PACid:22039276
Sequence length 707
Sequence
MSNKLSAGFSNGGKDCAGATSYIYSSVELFKKEGNRLVYRKINNLQLSLSHAEEKSKTFL
HFYHLLQISQTLILLQNPQFHTMQQGDYSSSYYQYPHPHPPPPSSHHHLQNPNPVDLQQS
NLNPSPSASPTTYASAPPFAPSNYTSSSDYSSHQNFPINNYPSYSHNPDPIPNLPPTAPP
SYQSFNPSPTHSSHQPSPFSSFNPVVIPEQPTSYSSIPPQPQQHQQQNPPSYYSPYDQHQ
SNYAVPPVTIPANPSPNPNPNSAFSSSYSNSSYNHLGSSIPPVYDAPYESNLKFDNRGGG
YLDDNASRYGVQQPAYTRSRSDVGGDFYEKRSESGFHYDRSGIQDDLSGQNAYLYTGGKV
EPYGARGTSGKSSTFAAFDDYGRSLSAPAKEQVSLKKVLKAVPKMETQQDVTNGVQKFRV
KLLAETGGQTPMDVLCQIGLDGIRMLDPTTSRTLRIYPLETITRSEVLDSSIFAFWSKST
VDIEPRRIRLKSSSYTTNTILDTVTAATIQEIGGKDSFRSRQSDPGKQSEQPTEKKKGFT
DWVNLIKPGNEEKDHWVPDEAVNKCTACGTDFGAFVRRHHCRNCGDIFCDKCTNGRTALT
AEENAQPVRVCDRCLAEVTQRLSNAKESTSKPAALYSHEDLAKKLQDEMDKNRKASSGAK
SSDGSGRRMKEVACPTCTVHLQVQVPSSGSETIECGVCQHPFLVNAH
Download sequence
Identical sequences A0A2G5C990
Aquca_075_00040.2|PACid:22039276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]