SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_076_00022.3|PACid:22030926 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_076_00022.3|PACid:22030926
Domain Number 1 Region: 171-444
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.63e-106
Family BC ATP-binding domain-like 0.0000000119
Further Details:      
 
Domain Number 2 Region: 729-991
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.06e-98
Family BC ATP-binding domain-like 0.000000304
Further Details:      
 
Domain Number 3 Region: 439-597
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 2.48e-52
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.0000605
Further Details:      
 
Domain Number 4 Region: 599-731
Classification Level Classification E-value
Superfamily PreATP-grasp domain 4.46e-47
Family BC N-terminal domain-like 0.00000287
Further Details:      
 
Domain Number 5 Region: 993-1131
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 1.83e-31
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.0013
Further Details:      
 
Domain Number 6 Region: 96-170
Classification Level Classification E-value
Superfamily PreATP-grasp domain 4.03e-19
Family BC N-terminal domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_076_00022.3|PACid:22030926
Sequence length 1139
Sequence
MGFCMKPCDSFCAKFTNSSLPFSISRSKNHYLTKSTSFPFYLYSKKTGTKKNVCALNHTL
RRRPVVCSVKSDSKVDSIHGEFDSVDGSFIGSSKGKRTDLKKILILGAGPIVIGQACEFD
YSGTQACKALKEEGYETALNLAVALAESGALEKYGIELIGAKLEAIKKAEDRDLFKQAMK
NIGVKTPPSGIANTLEECFQIADWIGEYPLIIRPAFTLGGSGGGIAYNKEEFETICKSGL
AASLTSQVLVEKSLLGWKEYELEVMRDLADNVVIICSIENIDPMGVHTGDSITVAPAQTL
TDKEYQRLRDYSIAIIREIGVECGGSNVQFAVNPVDGEVMVIEMNPRVSRSSALASKATG
FPIAKMAAKLSVGYTLDQIPNDITKKTPASFEPSIDYVVTKIPRFAFEKFPGSQSILTTQ
MKSVGEAMALGRTFQESFQKAVRSLECGFSGWGCAQIKELDWDWEQIKYGLRVPSPDRIH
VLYAAMRKGMKVDEIYELSYIDKWFLTQLKELIDVEQFLSVRTLSQLTRDDFYEVKKRGF
SDKQIAFATKSSEKEVRSTRLSLGVAPAYKRVDTCAAEFDADTPYMYSSYDYECESIPTQ
KKKVLILGGGPNRIGQGIEFDYCCCHTSFALQEAGYETIMMNSNPETVSTDYDTSDRLYF
EPLTVEDVLNIIDLERPDGIIVQFGGQTPLKLALPIQQYLDEQKLVTASGLGHVRIWGTS
PDSIDAAEDRERFNAIIKELEIKQPKGGIAKSDTDALTIANDIGYPVVVRPSYVLGGRAM
EIVYSDDKLVTYLETAVQVDPERPVLIDRYLSDAIEIDVDALADSYGNVVMGGIMEHIEQ
AGVHSGDSACSLPTKTVPSSCLDKIRTWTTKLAKRLNVCGLMNCQYAITPSGDLYLLEAN
PRASRTVPFVSKAIGHPLAKYASLVMSGKSLYDLEFTKEVIPRHVSVKEAVLPFEKFQGC
DVLLGPEMRSTGEVMGIDYEFPVAFAKAQIAAGQKLPVSGTVFLSLSDMTKQHLATIARA
FISLGFRIVSTSGTAQMLELEGLPVERVLKMHEGRPHAGDIITNGQIQLMVITSSGDGID
QIDGRQLRRMALAFKIPIITTVAGALATADAIRSMKQSGVKMMALQDFFSTVKSVSSTV
Download sequence
Identical sequences A0A2G5C8H7
Aquca_076_00022.3|PACid:22030926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]