SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_076_00030.1|PACid:22031118 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_076_00030.1|PACid:22031118
Domain Number 1 Region: 75-306
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.89e-63
Family BC ATP-binding domain-like 0.00000381
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily PreATP-grasp domain 0.0000000000144
Family BC N-terminal domain-like 0.00048
Further Details:      
 
Domain Number 3 Region: 315-384
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 0.0000000044
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_076_00030.1|PACid:22031118
Sequence length 390
Sequence
MNSNPETVSIDYYTSDILYFEPLTVKDVLKIERSDGIILAIPIQYLDEQKLVTAGGLGLV
RIWGTSPDSIDAAEDRGRFNAIVKDLKIEQSKGGLPRVICCSAFICAGGRVMEIVYSDEK
LVTYLETAVQVDLECPVLIDRYLSDAIEIGVDALAHSYGNVVMGAIMEHIEQAGVQCGDS
ACSLPTKTVPSCLDKIRTWTTKLAKSLIVCGLMNYQYAITPSGDLYLLEVNPHASRTVPF
VSKAIGHPLAKYASLVMSGKSLYDLEFTRHKFQGCDVLLCPEMRSTGEVMGIDYEAPVAF
AKAQIATGQRYLFLATIARAFISLSIRILSTSGTAQMLELEGLPVERVLKMQEGQPHAGD
MLSKVPIIATVAGALATADPIRRMKLNGVR
Download sequence
Identical sequences A0A2G5C9Q8
Aquca_076_00030.1|PACid:22031118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]