SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_077_00018.1|PACid:22041494 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_077_00018.1|PACid:22041494
Domain Number 1 Region: 481-798
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-80
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 51-160
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.88e-28
Family alpha-D-mannose-specific plant lectins 0.0055
Further Details:      
 
Domain Number 3 Region: 330-392
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000326
Family Hairpin loop containing domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_077_00018.1|PACid:22041494
Sequence length 814
Sequence
DTILPGQSIQDGQTILSSRETFALGFFSPGGNSTTNRYVGIWYNKISVQTIVWVANRENP
IQDRSGNLTIGRNGNLVVLDGTGRSLWSTNVSNVLSSNSSVVLLDSGNLILCDEGDCHPG
KALWQSFEEPTDTYLPGMRVGVNPRSNKDHFTSWKSETDPSRGNFSLGVDPQGLAEVVIW
EGSRKLWRSGLWNAQIFIGVPNMTANYLYGFRLGDDRGATFFTYSVHNSSETVRFRVRWD
GREEQLLWDEGKKTWTTFWSQPTIECEHYNKCGAFGSCTNTNSPICSCLRGFEPASRTEW
DSGNWSRGCVRRTELQCDRNITSVGDGERDWFLELDGAKLPDFSIMIPTNSRDNCAEMCL
SNCSCKAYAYVSGIQCLTWSQDFVDIQTFQEGGQTLYIRLAASELGESKNKLTLIIVLVV
VLGAIFIICTAAYIFWRCRAKSGSPKKESVVVDGTKSREFWTEFSAHEDVEANPAASGPE
LPMYSLQEIVTATNNFSSADKLGEGGFGPVFKGKLPCGKEVAVKRLSRKSGQGLEEFKNE
IILIAKLQHRNLVRLLGYCVEGEEKMLLYEYLPNKSLDAFIFANPKERLTWRKRYNIIEG
IARGLLYLHRDSRLRIIHRDLKASNILLDEEMNPKISDFGMAKIFGGNENEGNTNRVVGT
YGYMAPEYAMEGLFSVKSDVYSFGVLLLEIISGKKNQFRHPEYSMNLIGYAWNLWGEDRA
MEFVDPSIRDSCSNQSSVMRFINVGLLCVQDSPNDRPIMSTVVLMLESDTAILQTPRQPT
FTVGRNPMKMELSTDSSEVLISRNNITNTMVVGR
Download sequence
Identical sequences A0A2G5C847
Aquca_077_00018.1|PACid:22041494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]