SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_081_00011.1|PACid:22040130 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_081_00011.1|PACid:22040130
Domain Number - Region: 186-252
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00602
Family Myosin rod fragments 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_081_00011.1|PACid:22040130
Sequence length 352
Sequence
MQFKAYLDAIIMKPRRNGNFSAQNPRSFQGEGTNWILIAGGALLSTLSIRLGYRLKQVLD
TRRPDNASNSLKGHRKSSEKRSAGACALHSNMYSFTQNGDVCYSCLSGIPEGMVEVKRPQ
SGSMLKETDPNLPLVAIPAPESNRENGVMWTSSPDRLELPRKPFHHSNSSDSPCVSESGS
DIFSKREVIQKLRQQLKRRDDMILEMQDQIMELQNSLGSQLTHADLLQSQLNAANRDLFD
SEREIQRLRKAIADHCVRDTGHSEKPVAVRNWVTDNGHANGFSDGEMSFESVDKGRADGE
RIEMLKREVGELKEVIEGKDYLLQSYKEQKVELCSKVTDLQQRLVSQVPNIL
Download sequence
Identical sequences A0A2G5C7P2
Aquca_081_00011.1|PACid:22040130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]