SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_081_00021.1|PACid:22040129 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_081_00021.1|PACid:22040129
Domain Number 1 Region: 27-157
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-45
Family Necap1 N-terminal domain-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_081_00021.1|PACid:22040129
Sequence length 294
Sequence
MEKKSSKVDDHDHGGKHEEEEEEELVEAVELILFQVPECYVYMIPPRISAASYRADEWNV
NKWAWEGTLKVISKGEECIIKLEDKTTGELYARAFLRNGEPHPVEPVIDSSRYFVLRVEE
NIDGRLRHAFIGIGFRERPQAYDFQAALHDHMKYLDKKKTAEEMEQQYQKTSSVDYSLKE
GETLVLQIKNKGGHVKSALFEQGLNKLSLDEHTNKKECTICLKPPPPPPAPLSPVTAIGN
TPAKLPPKFTLEGSTKDVPLQSTDEYQSKEASSSQHENPDDPPEDDFGDFQKAG
Download sequence
Identical sequences A0A2G5C7M3
Aquca_081_00021.1|PACid:22040129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]