SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_082_00003.1|PACid:22026086 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_082_00003.1|PACid:22026086
Domain Number 1 Region: 513-887
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 8.5e-119
Family Oxysterol-binding protein 0.0005
Further Details:      
 
Domain Number 2 Region: 174-213,267-326
Classification Level Classification E-value
Superfamily PH domain-like 1e-19
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_082_00003.1|PACid:22026086
Sequence length 894
Sequence
MKGRKKSLRLRSLFDCDIPITITGIPNVPVTLSPFLSEPNLSEYPFFLFLLINVTDFLFF
LLSSSSLISNQTIRRATTTTAAVTDRWLLSISMHAFCCISTLDNSSSFISMKQQQQQQQP
ESTNNSRELSIEVMNLNAKNNVQNNDHRVVMFNEAQVVTTGVGVGDVMKMNGIIGICGIL
HKWVNYGKGWRPRWFVLQDGVLSYYKIHGPDRIELNQDFHKGSKVIGEESLRRITRKRNH
HSHHHHTHSHNYNNNNSLGQNQFNPNPVGEVHLKVSSIRESKSDDKRFSIFTGTKRVHLR
AETQDDRATWMETLQAMKDMFPRMSNCELMTPVANVVSTEKLRQRLLEEGVNEAAIQDSE
QIMRSEFSALQNELVLLKQKHSVLIDTLRHLETEKVDLENTLVDESQRQLKECEASSSRQ
DKCSDGSASESDDDHERHDVGEEETDEDENAFFDTRDFLSSSSFKSSGSDFQRSSFDSDN
EESEDGIDSSIKAVETNYPFIRRRKNLPDPVEKEKGVSLWSMIKDNIGKDLTKVCLPVYF
NEPLSSLQKAFEDLEYSFLLDRAYEWGKKGNNLMRILNVAAFAVSGYASTEGRNCKPFNP
LLGETYEADYPDKGLRFFSEKVSHHPMIVACHCEGRGWKFWGDTNLKSKFWGRSIQLDPV
GILTLEFDDGVVYQWSKVTTSIYNLILGKLYCDHYGTMRLQANSEYSCKLKFKEQSIIDR
NPHQVQGIVQDKNGKTVATMFGKWDESMHYVNGDYSGKGKGLESFPDAQLLWKRSKPPKF
PTRYNLTRFAISMNELTPGLKEKLPPTDSRLRPDQRCLENGEYEMANSEKLRLEQRQRQS
RKMQERGWKPQWFAKDKGSDTYRYIGGYWEAREKGNWDSCPDIFGQVSTDQMLD
Download sequence
Identical sequences A0A2G5C7F1
Aquca_082_00003.1|PACid:22026086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]