SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_082_00029.1|PACid:22026036 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_082_00029.1|PACid:22026036
Domain Number 1 Region: 60-147
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000126
Family B3 DNA binding domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_082_00029.1|PACid:22026036
Sequence length 186
Sequence
MVAKVLRKCIPVWETEMMGGLLSPRVDFKHVLESVVKMAGSSSGSARAINSCEHKPLQED
THWLWTHILTKSNVSEVFNMQIPKKFHPFLPFYSVDRVNLIHNKQIFKTETQNDRHDHLK
FTKGWRDFVRALNLKEGDSCVFEIIKPLPSDPIEIMVQILSGDLPEELITREANRGTSDE
SPIIID
Download sequence
Identical sequences A0A2G5C7I8
Aquca_082_00029.1|PACid:22026036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]