SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_083_00042.3|PACid:22058215 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_083_00042.3|PACid:22058215
Domain Number 1 Region: 229-434,470-481
Classification Level Classification E-value
Superfamily Pseudouridine synthase 6.66e-44
Family Pseudouridine synthase RsuA/RluD 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_083_00042.3|PACid:22058215
Sequence length 522
Sequence
MDDVVDSSVVELQLSLSDFDLSILASKVTAPFKPQNTLVGAYYKNIAIGIDRDFDLSARQ
RVMIECLQTKHSKDFLIVISMEGLGQRMTAVSTVSFSEEIKNKKENKWFTLPPFTSTINP
TSVSKQLFNTTNTTSSSSTTNNTTALKWILRCCPQLPHSLVQKLFRLRQVRKESSDLGRK
PQEQQLKRVSAKDELSVGDRLFLPISVQEKQKHERFDKQEYRCSKDEISYIRSLELHKDP
AIIVINKPHGLPVQGGIGIRNSLDVLAASALKYDYSEPPRLVHRLDRDSSGILVLGRTQT
SAAVLHSIFREKTSGASNEDFDNTKQILQRSYWALVIGTPKRTSGLVSVPLGKVIVDNGK
SERIMTVDDAQTMSCQHAVTEYRVIESHHGFTWLELRPLTGRKHQLRVHCAEVLRTPIVG
DYKYGWQAHRKWKPVPWSNPDKTEKLRGLNILPFGLDLESGSISEKQPHLHLHCKQMVLP
DVSLALQYMQSSKDHDLSQLQSLNLVAPLPLHMQRSWDILKS
Download sequence
Identical sequences A0A2G5C720
Aquca_083_00042.1|PACid:22058214 Aquca_083_00042.2|PACid:22058213 Aquca_083_00042.3|PACid:22058215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]