SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aquca_083_00091.1|PACid:22058206 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_083_00091.1|PACid:22058206
Domain Number 1 Region: 90-209
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.37e-29
Family Glutathione S-transferase (GST), C-terminal domain 0.0000297
Further Details:      
 
Domain Number 2 Region: 2-83
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.04e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_083_00091.1|PACid:22058206
Sequence length 215
Sequence
MAAVKVYGMPLSSCTARVLTCLIEKGVEYELIPLNLAVGEHKQPSFLAKQPFGQIPVLED
GDLTLFESRAIAKYVAYKYKDQGTDLLRHENVKESALVVVWTEVESQQYNPPISTLVYEL
LIKGMYGMTTDQAVVDAQSEKLGKVLDVYEARLTENKYLAGNFYSLADQNHIPYTYFLMK
TPAASLINCRPHVKAWWEDISSRPSFQKVLANANA
Download sequence
Identical sequences A0A2G5C768
Aquca_083_00080.2|PACid:22058326 Aquca_083_00091.1|PACid:22058206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]