SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_084_00050.1|PACid:22058407 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_084_00050.1|PACid:22058407
Domain Number 1 Region: 75-167,195-210
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.23e-28
Family alpha-D-mannose-specific plant lectins 0.002
Further Details:      
 
Weak hits

Sequence:  Aquca_084_00050.1|PACid:22058407
Domain Number - Region: 394-427
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00118
Family Pan module (APPLE domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_084_00050.1|PACid:22058407
Sequence length 445
Sequence
MSVSSHFLPFFLFLTLFFVSQAVVPPSQTFKYVINGEFGEYITEYDASYRLINVPNFATG
RLPFQLFFYNTTPDAYVFGLRMGRPRYESQLRWVWDANRANPVRENGTLTFAADGNLVLA
DVNGRVAWQTGTSNKGVAGIELLRNGNLVLKDKQGRFVWQSFEHPTDTLLVGSALTRGGR
NKLVSRVSDVDGSDGPYSLVLERDRLAMYLKSKNSPKPLLYYVTQLQSKSNSPISRVVFN
NKPLTEEAYEYELEYIVYNVNSSDGNTQFIGRPTKFNSTLSILRVGLDGSLKVYSFYDRV
QLGGWEVTFSAFDRDDLYGVSECRLPTKCGSLGVCEDNECVACPTPKGLLGWSKNCALPK
LPSCKPGSQVVNYFKVVGVEHFTYEYTQGEGPIKLADCRAKCSKDCGCLGFFYREESSKC
LVVPEVGTLSKVSNQTHVAYIKMSK
Download sequence
Identical sequences A0A2G5C6V9
Aquca_084_00050.1|PACid:22058407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]