SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_088_00008.1|PACid:22058033 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_088_00008.1|PACid:22058033
Domain Number 1 Region: 80-174
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.01e-23
Family B3 DNA binding domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_088_00008.1|PACid:22058033
Sequence length 178
Sequence
MKELADLKKDKETIGAARVPYATYEIGLFGMKVGLAPETTTNTTRVITTSVAATASQTEE
DGDYKLTKREKRALEAAPGFKSNYPWFAVPIVKSHKHQLILPFKFVKQHLPKESMNARIV
DSFERTWTVWYKYKKGRSLLYTGWNSFWLGNELKEGDVCAFELIDKEKIKLRVSIRKK
Download sequence
Identical sequences A0A2G5C6A3
Aquca_088_00008.1|PACid:22058033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]