SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_091_00023.2|PACid:22057807 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_091_00023.2|PACid:22057807
Domain Number 1 Region: 143-271
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000000681
Family DNA gyrase/MutL, N-terminal domain 0.05
Further Details:      
 
Weak hits

Sequence:  Aquca_091_00023.2|PACid:22057807
Domain Number - Region: 1217-1269
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00915
Family Myosin rod fragments 0.014
Further Details:      
 
Domain Number - Region: 1366-1482
Classification Level Classification E-value
Superfamily Smc hinge domain 0.0112
Family Smc hinge domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_091_00023.2|PACid:22057807
Sequence length 1519
Sequence
MERKSSSNLGKRLRFDEEEKDYRFKILLPNGTSVNLNLKRTVDDDMSLKEFIDRIRKEYD
RSVGIEVVKGRRKIVWRDPSICLEDLTGVKMPKTIPLMCYPPDKCHILRLHDGVKDSSDT
FENMWDLTPGTDILMELPQEYTFETALADLIDNSLQAVWSNARDERKLVSVSIGEDEISI
LDTGPGMDDSDKNSLVKWGKMGASLHRSAKRLAIGGKPPYLTPFFGMFGYGGAIASMHLG
RDASVFSKTKNSKKVYRLDLSREALINSREKTWKTGGSIRNPLEDEISASPHGSFTKVEI
SKLKVKLLDINQLKCRLKDIYFPYIQCDEMLGTGRTTTPIQFQVNGDDLADLTGGEVAIT
NMHSCHGPDFVLQLHLLYQDASTVTSSREPQKAHARLKCVYYPIVKGKESINTILESLRV
DGDTVAETFDTFCRASIRRLGRLLPDARWGRLPFMESRHRKGDRAQVLKRCCMRVKCFID
TDAGFSPTPSKTDLAHRHPCTVALKNFGNRTLEKDIDVSVEIFRGGKTLSISQLEKEYED
WVFEMHDKYDEESVCGEDDPIVVVLNPHNKKGLGISSNVVRVHKVIKRNGNTWKSGQHIK
ICKGAVGCHKNNLYAALEYIVLEGLEEDVCGEARLICRPLHVPVEKGCVIEIDDMNTTSL
DIRGSKSFPISVIDSGKCKVMEPAELKKQLEKLDQNSPSTIDILRSKDCHQLAIEEALPI
DGTVSAGSFSLKKVVAVLRPAFFDPGSSFRSLDQKSIIKADLEMSMEVTYLGEDYDPQEE
HIYAERSKPSVHGGIQGLYIFTVGSRNTKHFQKSGIYRFLFTVICEDSGCLKCEKRLIVL
PDTRVDQWKHLSDEKCRTYHVRVGSCSPPVSIACVDIYGNHMPFISSPGVLVKVESTNCV
MGHSRRMKVNLSSNRLILNISDIWIESSNLDSIRPHYKASLVISSQDELYCVRIPCQVTP
GVVFFVTDLCMELEKPLLPGSVIKQLVLELKDRFGNHIERGVEVSIHVEGLGFQDQKGST
REVDDKGYIDLSGVLKVKAGYGNLVSVFLNIGVESYYKKEFQVEQRKLRIVSTVPEYCAA
GSHLEDVVFEVVDSVGMVDEGIHDSKFGKHTLRITSELPGIHDSLQYSFIHGRCTVPFIP
IPEKEGICFIVAVHSNHPELCTNVEVHVVRTPQWQKESGYKAIEPPQCSDGGMLLLQDKA
VCIVNDAQELDNDVLRAASRIEEHEKKLKLLGEKKESLEQQILDLKESVEPEELNLLDYF
KMVRRIEGKDNTAASVICNMLEFSMSQRQEDECMQDIIGVVALLATVSTYDLSRILAEYL
REDNMLAVVCKSYATACTLEKYKEQGDIDHSDALHAIAAELGKSIDGRFDVIYLEGIRPY
AGKIEDGPQRRLVLADPLLPTGDIPTGFIGYAVNIIKLDARFICTRTIGGHGLRETLFYH
LFGELQVYKTRKCMKKACSSIKHGAVSLDGGILRGNGVFSYGVGMLSCVSIGCSVATFFT
ISEYSQRNNTYGVGVRSHV
Download sequence
Identical sequences A0A2G5C6W7
Aquca_091_00023.2|PACid:22057807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]