SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_091_00023.5|PACid:22057810 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_091_00023.5|PACid:22057810
Domain Number - Region: 1140-1259
Classification Level Classification E-value
Superfamily Smc hinge domain 0.00497
Family Smc hinge domain 0.0062
Further Details:      
 
Domain Number - Region: 991-1043
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00811
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_091_00023.5|PACid:22057810
Sequence length 1352
Sequence
MFGYGGAIASMHLGRDASVFSKTKNSKKVYRLDLSREALINSREKTWKTGGSIRNPLEDE
ISASPHGSFTKVEISKLKVKLLDINQLKCRLKDIYFPYIQCDEMLGTGRTTTPIQFQVNG
DDLADLTGGEVAITNMHSCHGPDFVLQLHLLYQDASTVTSSREPQKAHARLKCVYYPIVK
GKESINTILESLRVDGDTVAETFDTFCRASIRRLGRLLPDARWGRLPFMESRHRKGDRAQ
VLKRCCMRVKCFIDTDAGFSPTPSKTDLAHRHPCTVALKNFGNRTLEKDIDVSVEIFRGG
KTLSISQLEKEYEDWVFEMHDKYDEESVCGEDDPIVVVLNPHNKKGLGISSNVVRVHKVI
KRNGNTWKSGQHIKICKGAVGCHKNNLYAALEYIVLEGLEEDVCGEARLICRPLHVPVEK
GCVIEIDDMNTTSLDIRGSKSFPISVIDSGKCKVMEPAELKKQLEKLDQNSPSTIDILRS
KDCHQLAIEEALPIDGTVSAGSFSLKKVVAVLRPAFFDPGSSFRSLDQKSIIKADLEMSM
EVTYLGEDYDPQEEHIYAERSKPSVHGGIQGLYIFTVGSRNTKHFQKSGIYRFLFTVICE
DSGCLKCEKRLIVLPDTRVDQWKHLSDEKCRTYHVRVGSCSPPVSIACVDIYGNHMPFIS
SPGVLVKVESTNCVMGHSRRMKVNLSSNRLILNISDIWIESSNLDSIRPHYKASLVISSQ
DELYCVRIPCQVTPGVVFFVTDLCMELEKPLLPGSVIKQLVLELKDRFGNHIERGVEVSI
HVEGLGFQDQKGSTREVDDKGYIDLSGVLKVKAGYGNLVSVFLNIGVESYYKKEFQVEQR
KLRIVSTVPEYCAAGSHLEDVVFEVVDSVGMVDEGIHDSKFGKHTLRITSELPGIHDSLQ
YSFIHGRCTVPFIPIPEKEGICFIVAVHSNHPELCTNVEVHVVRTPQWQKESGYKAIEPP
QCSDGGMLLLQDKAVCIVNDAQELDNDVLRAASRIEEHEKKLKLLGEKKESLEQQILDLK
ESVEPEELNLLDYFKMVRRIEGKDNTAASVICNMLEFSMSQRQEDECMQDIIGVVALLAT
VSTYDLSRILAEYLREDNMLAVVCKSYATACTLEKYKEQGDIDHSDALHAIAAELGKSID
GRFDVIYLEGIRPYAGKIEDGPQRRLVLADPLLPTGDIPTGFIGYAVNIIKLDARFICTR
TIGGHGLRETLFYHLFGELQVYKTRKCMKKACSSIKHGAVSLDGGILRGNGVFSYGVGEP
KVCFPVSVSDVQWQLSSLSVSILKEITLMESELEATSDEIKKELKAQYVDFLEFKQKKDR
YHNFLNTKEAVVSEVCHAYSQIVKTESSELDT
Download sequence
Identical sequences A0A2G5C5H7
Aquca_091_00023.5|PACid:22057810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]