SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_091_00031.1|PACid:22057925 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_091_00031.1|PACid:22057925
Domain Number 1 Region: 298-581
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.05e-87
Family WD40-repeat 0.0000323
Further Details:      
 
Domain Number 2 Region: 146-201
Classification Level Classification E-value
Superfamily PRP4-like 0.000000000000011
Family PRP4-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_091_00031.1|PACid:22057925
Sequence length 596
Sequence
MVQEEIPKDPSSSEELFATPMPVDDQPLASVVDVPVLQPAISLVPPVVIPIQTPQLPILQ
PAIPPPPIPPPVVPPIAPIPTISPVPRPLAPLPVRPPIRPPPKKDEEDDSDSDSGNDESG
PKRGASAMEYEISEESKQAKERQEKAVQELLMKRRAYALAVPTNDSAVRARLRRLSEPIT
LFGEKEMERRDRLRMIMVKLDAEGQLERLLKAHEDEEAAASAAAEEGDGEGPQTYPFYTE
GSNALLEARRDIAKYSIVRTALRLERARRRRDDPDEDVDAEMNWALRQAGDLVLDCSEIG
DDRPLTGCSFSHDGKKLATCAMSGAIKLWSMPQVTRVGTLKGHTERATDVAFSPVDNHIA
TASADHTAILWNPEGSMLKKFEGHLDRLARVAFHPSGKYLGTASFDKTWRLWDINTGVEL
LLQEGHSRSVYGICFNRDGSLAASCGLDALARVWDLRTGRSILALEGHVKPVFGVSFSPN
GYHLATGGEDNTCRIWDLRKRKCIHIIPAHSNLISQVKFEPQEGYFLATASYDMTAKVWS
ARDFKPIKTLSGHESKVTALDIIGDGQCIATVAHDRTIKLWSCRSNEKEKAMDIDQ
Download sequence
Identical sequences A0A2G5C5L4
Aquca_091_00031.1|PACid:22057925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]