SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_093_00005.3|PACid:22058103 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_093_00005.3|PACid:22058103
Domain Number 1 Region: 735-767
Classification Level Classification E-value
Superfamily WW domain 0.0000000128
Family WW domain 0.0025
Further Details:      
 
Domain Number 2 Region: 8-39
Classification Level Classification E-value
Superfamily WW domain 0.000000487
Family WW domain 0.0031
Further Details:      
 
Weak hits

Sequence:  Aquca_093_00005.3|PACid:22058103
Domain Number - Region: 398-540
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00288
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_093_00005.3|PACid:22058103
Sequence length 768
Sequence
MQTTEEVIFGWKLVIHEETNQYYYWNIETGETSWEAPAIFAQGMEVGTEQKALPVIEERE
GTFSNTTAYDTLHTEPVVYSSVPAGDQCNGAAFISNDEEKCKPSHQAEIVKKGHTEENLV
VVNPELNSGIHTEVISTEIRTNPVSKCVDEHILVANGHPEAGLAHPTQLVSYAESLIQRL
KDLERSDIQLQGWDWISRYILEIEMRLSDFNSLLVYGSSLFPFWMHSEEKLRGLECAIND
HISQLTMSGQTNRGTGSTPHLSIEGDSELNVANQTLVPSCSSPNIDTAIIQKEADDKITL
DDATFVKGNIPAVNETVHPKEFVLQSVSSAVEDEDMDVDMEVEDETPINGQRSRDALGAK
FFSPPEQFIQPDLPRDLPPSVLETEYDVPPPPDEEWIPPPPPDAEPVPPPPPPPDEPPSP
TYIPQPPYSEAVPYLPYTAQYNMSYPLSGSEYYGPVTTEVPSLNYYAHAEEPQAVESQSV
QYFDAVSATTSTIVNPMDPLVYYGLPSGPAPLVPSMIYGESGSLSCHNATAEQKKTLTSL
AESESSLLPNLKGDSVAFAVSQETEKLAEQAAPLSATVQATTTTAPVPSTIAISGAISQP
TSAAKAPTKVAGMRIKKRTIGVTPTLRSNKKVSSLVDKWKAAKEELHEDEEDEPKNAYEM
LERKRQREIEAWRAQQIASGEAKDNANFQPLGGDWRERVKKRRRAKSSIGESVQSLPDAS
MDGKQPPDLIELSKDLPPGWQVYWDESSQKPYYGNTITSETTWTRPTQ
Download sequence
Identical sequences A0A2G5C553
Aquca_093_00005.3|PACid:22058103 Aquca_093_00005.4|PACid:22058104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]