SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_093_00015.1|PACid:22058143 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_093_00015.1|PACid:22058143
Domain Number 1 Region: 488-761
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.31e-55
Family Protein kinases, catalytic subunit 0.001
Further Details:      
 
Domain Number 2 Region: 79-166,199-230
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-24
Family alpha-D-mannose-specific plant lectins 0.0046
Further Details:      
 
Weak hits

Sequence:  Aquca_093_00015.1|PACid:22058143
Domain Number - Region: 363-415
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00157
Family Anti-platelet protein 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_093_00015.1|PACid:22058143
Sequence length 789
Sequence
MESRSQTWCFLFFFFFLLLSTQTYFCVAVDTISSGQSLTFNQTLISTGGNFELGFFKPGN
SSNYYIGIWYKKVSVQKKTVVWVANRHSPLSNDSISSSEFKLLDDGNLVVLNQSKITVWS
TNLTLSNNNAMNSTHQVVLRDDGNLVLRNGIKDSDVYWQTFDYPSDTWLPGGKLRYDNIT
KKPQLLLTSWKNENDPSEGLFSLELIPEEKAYVIRWNRTERYWTSGPWNGQTFSKVPELR
LNYIYNFIYNPGVNESYFTYSVYNKSNISRFVMDLSGQIKQFTWAEGSQSWFLFWSQPRT
QCEVYAFCGPFGVCSQGGLPFCTCMEGFEPRSPKDWNMLDFSGGCVRKTLLECGDKDVFS
MMSNVKLPDNEKPLQSAASADECKLACTRNCSCNAYAYTSGCSIWDGDMLNLQQHTDNDG
DGSDLYLRIAASDVRKSPGGKSKGSNSTGIIVGAAVGILALCLFLFVFWRWRKRQSVGTS
KTVVEGSLVAFTYRDLQSATKNFSEKLGGGGFGSVFKGILPDSTAIAVKKLEGLGQGEKQ
FRSEDAKMLNWKTRYQIALGTARGLTYLHEKCRDCIIHCDIKPENILLDADFCPKVADFG
LAKLIGRDFSRVLTTMRGTRGYLAPEWISGVAITAKADVYSYGMMLLEIISGRRNSEHSE
DGKIMFFPTWAARKIAEEEDALALLDSKLEGDVNEEELTRASRVACWCIQDDESHRPSMG
QVVQILEGILEVNSPPIPRTLQVLGENEENIHFFSDTTSNRSSQVQSTSSASSQTKSSIS
STSSKSQKD
Download sequence
Identical sequences A0A2G5C581
Aquca_093_00015.1|PACid:22058143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]