SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_093_00020.1|PACid:22058053 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_093_00020.1|PACid:22058053
Domain Number 1 Region: 487-760
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-54
Family Protein kinases, catalytic subunit 0.00095
Further Details:      
 
Domain Number 2 Region: 79-166,198-229
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.27e-24
Family alpha-D-mannose-specific plant lectins 0.0046
Further Details:      
 
Weak hits

Sequence:  Aquca_093_00020.1|PACid:22058053
Domain Number - Region: 361-412
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00144
Family Pan module (APPLE domain) 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_093_00020.1|PACid:22058053
Sequence length 788
Sequence
MESRSQTWCFLFFFFFLLLSTQTYFCIAVDTISSGQSLTFNQTLISTGGNFELGFFKPGN
SSNYYIGIWYKKVSVQKKTVVWVANRHSPLSNDSISSSEFKLLDDGNLVVLNQSKITVWS
TNLTLSNNNAMNSTHEVVLRDDGNLVLRNGIKDSDVYWQTFDYPSDTWLPGGKLRYDNIT
KKPQLLTSWKNENDPSEGLFSLELIPEEKEYVIRWNRTEQYWTSGPWNGQIFSGVPEMRL
NFIYNFSYNPGVKESYFTYSVYNTSIISRFVMDLSGQIKQFTWAEGSQSWFLFWSQPRTQ
CEVYAFCGPFGVCSQGGLPFCTCMEGFEPRSPKDWNMLDFSGGCVRKTLLECGDKDAFPM
MSNVKLPDNEKPLQSAASADECKLACTRNCSCNAYAYRSGCSIWDGDMLNLQQHTDNDGD
GSDLYLRIAASDVRKSPGGKSKGSNSTGIIVGAAVGILALCLFLFVFWRWRKRQSVGTSK
TVVEGSLVAFTYRDLQSATKNFSEKLGGGGFGSVFKGILPDSTAIAVKKLEGLGQGEKQF
RSEDGKMLKWKTRYEIALGTARGLTYLHEKCRDCIIHCDIKPENILLDADFCPKVADFGL
AKLIGRDFSRVLTTMRGTRGYLAPEWISGVAITAKADVYSYGMMLLEIISGRRNSEHSED
GKIMFFPTWAARKIAEEEDALALLDSKLDGDVNEEELTRASRVACWCIQDDESHRPSMGQ
VVQILEGILEVNSPPIPRTLQVLGENEENIHFFSDTTSNRSSQVQSTSSASSQTKSSISS
TSSKSQKD
Download sequence
Identical sequences A0A2G5C571
Aquca_093_00020.1|PACid:22058053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]