SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_095_00055.1|PACid:22042414 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_095_00055.1|PACid:22042414
Domain Number 1 Region: 893-1240
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.93e-121
Family Motor proteins 0.0000000000376
Further Details:      
 
Domain Number 2 Region: 379-496
Classification Level Classification E-value
Superfamily Second domain of FERM 1.7e-20
Family Second domain of FERM 0.0018
Further Details:      
 
Domain Number 3 Region: 501-589
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000203
Family Phosphotyrosine-binding domain (PTB) 0.049
Further Details:      
 
Domain Number 4 Region: 836-897
Classification Level Classification E-value
Superfamily Prismane protein-like 0.000000705
Family Acetyl-CoA synthase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_095_00055.1|PACid:22042414
Sequence length 1269
Sequence
MTLDATPSIMSTVRGTTTRSSLTSTNGGGNTTPLHTDEDDYDSDGSNFAPPTPMTLSMAI
PPELAGAIPLIDRFQVESFLRSMQKQIQSSGKRGFFSKRSVGPQIRDKFTFEDMLCFQKD
PIPTSLLKINSDLVSRAIKLFQLILKYMGVDSADRVAPISLEERIELVGKLYKQTLKRSE
LRDELFAQISKQTRNNPDRQCLIKAWELMNLCASSMPPSKDIGGYLSEYVHYVAHEANTD
SKVQVLALNTLNALKRSVKAGPRHSIPGREEIEAFLTGKKLTTIVFFLDETFEEITYDMA
TTVADAVEELAGIIKLSAFSSFSLFECRKVVSGSKSPEPGNEEFIGLDDNKYIGDLLAEF
KVAKDRSKGEILHCKLTFKKKLFRESDEAVEDPMFAQLSYVQLQHDYIMGNYPVGRDDAA
QLSALQILVEIGFVGNPDSCTEWTSLLERFLPRQIAITRAKRDWEMDIITRYRSMEKLSK
DDARQQFLRILRSLPYGNSVFFSVRKIDDPIGLLPGRIVLGINKRGVHFFRPVPKEYLHS
AELRDIMQFGSSNTAVFFKMRVAGVLHIFQFETKQGEEICVALQTHINDVMLRRYSKARS
SSSVSVNGDISQNHKTPSVDGYEKRVQELSKAVEESQRNADRLLEELREKEEHEVRMWEE
LEGLKDALRLEKEKLVEVVCEREKLKSLYDEKVAALQVAISERRSMEARLAKIEKEGALE
DSAKKDKLGSTDKQAITKLQEELRVHKDELNAAEENLKRLANEKLLMEQKVVRAEKKNSD
EIEVLERKFEQERRTHRLRVSELEKKLEGVRKDLAASESILSDRNMELDTLQNNLRELEE
LREMKEDIDRKNEQTASLLKKQGAQLLELEALYKEEQVLRKRYFNTIEDMKGKIRVFCRL
RPLSEKEISERQKNILRSLDEFTVEHPWKDDKIRQHMYDHVFDEAASQEDIFEDTKYLVQ
SAVDGYNVCIFAYGQTGSGKTFTIYGSENNPGLTPRATAELFKILKRDSNKYSFSLKAYM
VELYQDTLVDLLLPKNAKRLKLDIKKDMKGMVSVENVTVVPISTFEELRNIISRGSEQRH
TSGTQMNDESSRSHLILSVVIESTNLQTQSVARGKLSFVDLAGSERVKKSGSEGKMLKEA
QSINKSLSALGDVISALSSDNQHIPYRNHKLTMLMSDSLGGNAKTLMFVNVSPAESNLDE
THNSLTYASRVRSIVNDPSKNVSSKEVNRLKKLVAYWKEQAGKRVDDEELEEIQDERPPR
ERVDGRYSM
Download sequence
Identical sequences A0A2G5C4U6
Aquca_095_00055.1|PACid:22042414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]