SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_100_00005.1|PACid:22063742 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_100_00005.1|PACid:22063742
Domain Number - Region: 129-286
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000136
Family WD40-repeat 0.07
Further Details:      
 
Domain Number - Region: 247-375
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0863
Family YVTN repeat 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_100_00005.1|PACid:22063742
Sequence length 1507
Sequence
MGSRVGMEVPITATDQLKWIEVSIPSSSSSSLPSLPPITATYTDNDEDSSSSRNTFAPYT
EDCASCHIIGDPSTYLIWRIHKSLPNALEVMELTACNEVPRIGLRLLFPDALSPFVFICQ
DENSSSIHNPYLLYTLTVSGVAYLFKLRSVAEYASCSIFPQNEFIEFNLQALSQSAPITA
VTATKGCLVVGRHDASVACFQLGVLNTTAQGFMHELRDDVGIVRLWGLMARGRTVAPVQD
IVIAEPHGRKVIFVVHVDGSLRVWDLLGHTKLFNHTISSATLTGCIVSRLWVGEFNQDTC
LVSLAALYTSTEVDMETIVIFSLGFNLDGKVSLLPDSSMQIIPLEEGVLIDLIITTKKLW
ILKEDGLVSYDFSDNKFELEVAQSYCLQEDLVADQLFQSPEHSLDGLSWTSLSLSSVKDQ
IVPFVSSIFLRRLLQPGIYQNATLRATAHDYNKLWTDTEFQSLTVDGLKKEIFSLIEGEV
AVPKSIVYCWKKFCRQYFHYWCKNNALYGLLVDPSTGAIGLIRKKTISLFRCLEDIELLI
YGSFDEFGDFAGLNLPNDFLDREILFEVLRCISNIHQQLGKAGSAIFYESLINSQLLSSE
EVVPGFLKILETGYSSSAAKLHVSQFGADTAWKKELEDHRNQRKFSIDMLLSLHALLGKA
ASWDRVLNVVENFFKFLVPHKRSQRLEAEAVFNINSSALILSTSQVARVMFESAFDILLL
LGYLVNVRGQIHMMYNDISRIQLELIPMIQETLTEWAILHFMGTTPSESPPLEDFSTRLS
SLHIDSSTIRRSWNQKLGTCDFTLACLLFLSSQHSSEDLIFLSSRSFPSPNGIISTVQNF
SSWVIWGRTGEEFPTFFNRPIELGMILLRHGQYEAVENLFGMIDAHSRKERTSESVQDSN
GDWCKYLHLLGFCLVARAQCELHGVVKERKVREAVRCFFRASSGLGASQALQSLSFEGLP
QLGYTSCGSEAEWKLHYYQWAMQIFEQYNLSEGACQFALAALEQVDEILGSKYDKCGGDL
LNESATTVRGRLWANVFKFTLDLNYYCDAYCAIISNPDEDSKHICLRRFVIVLCERGAYK
TLCDGQLPFVGLTEKMEQELAWKAERSDVGAKPNPYKLLYAFEMHRHNWRRAASYMYRYS
VRLRSEVAFKEHQHRSTTLQERLNGLSAAINALNLVHPDYAWIDPQLDGYSCLDDVYPNK
KARKVGEESLSDCSVQSWRLQYCVDCEKLEQEYVQTSAEYSLSLANVKPKDKGNQANPSG
LVDLLVQTNLYDMAFTVLLKFWKDSELKRELERVFIAIALKCCPNSGVSSMGTHGLLLTA
SEEESCINDAMETSPSVHQSKGNSQWETLELNLGKYMKLHPRLPVIVAETLLHTDPQMEL
PLWLVLMFKGGRRATSWGMTGLEANPGSLFSLYVDYGRYTEATNLLLEYIESFASQRPAD
IMNRKKMSAIWFPYTTIERLWCQLEETRSSGHMIDQCDQLKRILQGALLSHLKLIEVDSH
DAVSSAA
Download sequence
Identical sequences A0A2G5C435
Aquca_100_00005.1|PACid:22063742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]