SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_100_00011.1|PACid:22063739 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_100_00011.1|PACid:22063739
Domain Number 1 Region: 45-80
Classification Level Classification E-value
Superfamily WW domain 0.000000174
Family WW domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_100_00011.1|PACid:22063739
Sequence length 184
Sequence
MASITALEQSFQNCSLNRSNGSGLRTSEDAVHEEEEEDTSLELNSHLSLPYQWEQCLDLK
TGEIYYINWENGMKRKDDPRKITSSRESCYYSEEDNTNNNSYDSDDGSSSASSPSPLNGG
QEEEQEHYNNTNQEGGEGVDHILVVAGCKTCMMYFMLPKRVEECPKCNGFLLHFDRLEHD
DGSL
Download sequence
Identical sequences A0A2G5C418
Aquca_100_00011.1|PACid:22063739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]