SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_108_00026.2|PACid:22046187 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_108_00026.2|PACid:22046187
Domain Number 1 Region: 859-1089,1135-1178
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.65e-35
Family Pyruvate phosphate dikinase, N-terminal domain 0.026
Further Details:      
 
Domain Number 2 Region: 64-156
Classification Level Classification E-value
Superfamily Starch-binding domain-like 2.18e-19
Family Starch-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_108_00026.2|PACid:22046187
Sequence length 1179
Sequence
MASSSRLFNFPSSSSFCKDDHHTKLFSNSKRRISFPNFRIACTGVSFVQREEDKKNNNNN
NSMPNGKVLLRVTLNHQVKFGEHVAIFGSLKELGSWKKKFNMNWTQDGWVCEIQSKGAES
LEFKFVIVNKNNNMIWEGGNNRVLKLPNGGGAFEMVCHWNNTGEDLKLKSLDSQHVTESN
GTIEISRIPPVNDSAEGGGPSPFVEQWQGRAASFMKSNEHRDREGSRNWDTSALQGFALK
LVEGDRNARNWWRKLELVRELLAGSLEDGDRLDALIYSSIYLKWINTGQVPCFEDGGHHR
PNRHAEISRLIFRELERISYRKDTSPQEVLVIRKIHPCLPSFKSEFTASVPLTRIRDIAH
RNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEAMLARITRNHGEYSEAFVEQFKIFHTE
LKDFFNAGSLTEQLESIKESLDDKSLSALSLFLECKKSLDKLEEPSNFLKKDGADLLMNA
LRSLMSLRAALVKGLESGLRNDAPDAAIAMRQKWRLCEIGLEDYSFVLLSRFLNALEAMG
GSSWLAQSANAGSINASSWNDPLHALTIGIGQLGLSGWKQEECIAIENELLAWKQKGLTE
EEGSEDGKTIWALRLKATFDRSRRITEEYSEALLQILPERVQMLGKALGVPENNVRTYTE
AEIRASVIFQVSKICTLLLKAIRSILGSQGWDVLVPGAAFGTLVQVETIASGSFPQSNLG
PIILVVNRADGDEEVTAAGNNIVGVVLLQELPHLSHLGVRARQEKVVFLTCEDEDKVSHI
RSLNGQSVRLEASSAGVDLFPSALTESKEVLPVISGTETKTKTESPTSKSSSWSVTKTSD
SSQSVSTGAIPLTDADTRTSGAKAFACGQLASLAALSDKVYSDQGVPASFSVPAGAVIPF
GSMESALKASGSIEAFQSLIEKIETAKVEGGELDKICSELQELISSQRPTTETIDSLANI
FPSNKRLIVRSSANVEDLAGMSAAGLYDSIPNVSPSNPLVFGKAIGRVWASLYTRRAVLS
RRAAGVPQKDATMAILVQEMLSPDLSFVLHTMSPTDRDSNSVIAEIAPGLGETLASGTRG
TPWRLSSGKFDGQVRTLAFANFSEELLVLGGGPADGEMVHLTVDYSKKPLTIDPVFRRQL
GQRLCAVGFFLEQKFGCPQDVEGCLVGKDIYIVQTRPQP
Download sequence
Identical sequences A0A2G5C3B1
Aquca_108_00026.2|PACid:22046187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]