SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_111_00007.1|PACid:22045168 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_111_00007.1|PACid:22045168
Domain Number 1 Region: 527-627,870-1029
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000275
Family WD40-repeat 0.036
Further Details:      
 
Domain Number 2 Region: 34-179
Classification Level Classification E-value
Superfamily Putative isomerase YbhE 0.0000654
Family Putative isomerase YbhE 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_111_00007.1|PACid:22045168
Sequence length 1213
Sequence
MYLYSLTLQQATGIVCATNGNFIGGKSQEIVVARGKVLDLLRPDENGKLQTILSVEVFGA
IRSLSHFRLTGSQKDYIVVGSDSGRIVILEYNKEKNVFDQIHQETFGKSGCRRIVPGQYI
AVDPKGRAVMIAACEKQKLVYVLNRDSTARLTISSPLEAHKSHTIVYSIAGVDCGFDNPI
FASIELDYLEADQDSTGQSANEAQKHLTFYELDLGLNHVSRKWSEPIDNGANMLVTVPGG
GDGPSGILVCAENFVIYKNQGHPDVRAVIPRRADLPAERGVLIVSAATHRHRATFFFLLQ
TEYGDVFKCTLEHDNDRVTELKIKYFDTIPVTISMCVLKTGFLFAASEFGNHGLYQFRAI
GEEADVESSSSTLMETEEGFQPVFFQPRGLKNLIRIDQVDSLMPIMDMKVANLFEEETPQ
IFTLCGRGPRSSLRILRPGLAVSEMAVSQLPGIPIAVWTVKKNINDEFDAYIVVSFASAT
LVLSIGETVEEVSDSGFLDTTPSLAVSLLGDDSLMQVHPKGIRHIREDGRIIQWETPGKR
TIVKVATNRVQVVIALSGGELVYFEMDITGKLMEVEKHEMSGDVACLDIAPVPEGRQRSR
FLAVGSYDNTIRILSLDPDDCMQVLSLQSVSSPPESLLLLEVQASVGGEDGADHPASVFL
NAGLQNGVLFRTVVDMVTGQLSDTRSRFLGLRAPKLFSAVVRGRRAMLCLSSRPWLGYIH
QGHFLLTPLSYETLEYAASFSSDQCAEGVVAVAGDALRVFTIERLGETFNETVIPLRYTP
RKFVLHPKRKLLIVIESDQGAFTAEEREAARKECLEAAGMEENGNGNIDEMENGAENEEN
DPLSDEQYGYPKAEAEKWVSCIRVFEPRTTTTTCLLELQDNEAAFSVCTVNFSDKEYGTL
LAVGTAKSLKFWPKRSFAAGFIHIYRFIEDGKGLQLLHKTQVEGIPLALCQFQGKLLAGI
GSVLRLYDLGKRKLLRKCENKLFPNTIISLHTYRDRIYVGDIQESFHYCKYRRDENQLYI
FADDSVPRWLTASYHIDFDTMAGADKFGNVYFMRLPQDLSDEIEEDPTGGKIKWEQGKLN
GAPNKVEEIVQFHVGDVVTCLQKTSLIPGGGECLIYGTVMGCLGALLAFTSREDVDFFSH
LEMHMRQEHPPLCGRDHIAYRSAYFPVKDVIDGDLCEQFPTLPADLQKKIADELDRTPGE
IMKKLEDVRNRII
Download sequence
Identical sequences A0A2G5C2M9
Aquca_111_00007.1|PACid:22045168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]