SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_111_00019.2|PACid:22045218 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_111_00019.2|PACid:22045218
Domain Number 1 Region: 156-200,242-344
Classification Level Classification E-value
Superfamily Pseudouridine synthase 5.28e-36
Family Pseudouridine synthase RsuA/RluD 0.00022
Further Details:      
 
Domain Number 2 Region: 93-183
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.0000000000303
Family Ribosomal protein S4 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_111_00019.2|PACid:22045218
Sequence length 347
Sequence
MLSLSCSSSSSLVAFACCCSSSSSKILCSSSSLLSLLPLNPRRKSITRSLSSSSSAASIE
LEESISSESSNGNYAGVQLQEIVQIEKNNGDGLWKSRIDSWISSRIHGVSRARVQSSIRA
GLVTVNGRIIDKVSHVIRAGDKVNCTISELQPLRAVPEDIPIDIVYEDEHVLVVNKPAHM
VVHPAPGNANGTLVNGLLNHCNLPTITLQSNDILSESEDDCDNEDNDSIDDQTSCMEISP
NMTGSSVRPGIVHRLDKGTSGLLVVAKDEHSHAHLSEQFKQHTIHRVYVSLTSGVPSTLS
GRVEVPIGRDTNNRVRMAAIPGPNISRQTPRQVQSNGSTSRWWFCIG
Download sequence
Identical sequences A0A2G5C2T6
Aquca_111_00019.2|PACid:22045218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]