SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_114_00033.1|PACid:22024772 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_114_00033.1|PACid:22024772
Domain Number 1 Region: 194-459
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.83e-30
Family Creatinase/aminopeptidase 0.00057
Further Details:      
 
Weak hits

Sequence:  Aquca_114_00033.1|PACid:22024772
Domain Number - Region: 845-915
Classification Level Classification E-value
Superfamily PH domain-like 0.0553
Family SSRP1-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_114_00033.1|PACid:22024772
Sequence length 1065
Sequence
MADHRNGSAAGGGPSYDIDLQHFMKRLKVFYSHWKENKVDLWSSSDALVVATPPASDDLR
YLKSSALNMWLLGLEFPETIMVFMNKQIHFMCTQKKASLLENLKRPAKETVGAELVMHVK
TKSDDGTALMDEIFRAIRAQSKSSGPDSPIIGYIAKEAPEGKLLETWGDKLKNSSFQLVD
VTNGFSELFAVKDNTEITNVKKAAYLTASVMKLHVVPKLEKIIDEEKKVSHSTLMDDTEK
SILEPTRVKVKLKAENVDICYPPIFQSGGEFDLKPSASSNDENLYYDSTSVIICAIGSRY
NSYCSNVARSFLIDANTQQSKAYEVLLKAQQAAIDALKPGNKVSAAYQAAFSLVERDAPE
LIQNLTKSAGTGIGLEFRESGLTLNAKNDRVLKAGMVFNVSLGFQNLQAQTNNPKTEKFS
LLLADTVIVNEAEKPPEVVTAISSKAVKDVAYSFNEDEEEEEVQPKAKVESNGTNALLSK
ATLRSENQESKEEVRRQHQAELARQKNEETLRRLAGGGSGSGDSRGAGKSSSSLIAYKNV
NDIPTPRDLMILVDQKNEAIHLPIYGSMVPFHVATVKSVTSQQDNRTCYIRIIFHTPGSA
FSPLDANFSKFQGAIYLKEVSFRSKDPRHISEVVQQIKTLRRQVASRESERAERATLVTQ
EKLQLAGTKFKSIRLPDLWIRPAFGGRGRKLTGTLEAHVNGFRYSTSRPDERVDIMYANV
KHPFFQPAEKEMITLLHLHLHNHIMVGNKKTKDVQFYVEVMDVVQTLGGSRRSAHDPDEI
EEEQRERDRKNRINLDFQNFVSKVNELWAQPQFNGLDLEFDSPLRDLGFHGVPYKASAFI
VPTSTCLVELVENPFLVITISEIEIVNLERVGLGQKNFDMTIVFKDFKRDVLRIDSIPSS
SLDGIKEWLDTTDLKYYESRLNLNWRPILKTITDDPEKFFEEGGWEFLNMEASDSDSENT
EDSDQGYAPSDVQSDSVSEEEDDDSESLVESDEDEEEDTDEDSEEEKGKTWEELEREASN
ADREKGDESDSEEERQRRKMKAFGKSRIPDKRDPRGGPSKRSKLR
Download sequence
Identical sequences A0A2G5C2F5
Aquca_114_00033.1|PACid:22024772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]