SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_118_00014.1|PACid:22042547 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_118_00014.1|PACid:22042547
Domain Number 1 Region: 92-239,271-353
Classification Level Classification E-value
Superfamily Pseudouridine synthase 8.8e-46
Family Pseudouridine synthase RsuA/RluD 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_118_00014.1|PACid:22042547
Sequence length 372
Sequence
MWLRPCCLFSPPPPPYLFFTKISITTNLKFLCNSSHRLVMEDQTINENKSNDPKPSDYPI
PLSPPLPAISKQIELNRAMSASSLSSLFSLSSKDVIFEDEWLIVVNKPQGVYCENLLSSI
PSLLMNSTDLTIPIFEKKPPELHLANRLDRDTSGLMVITKSHKVAGKLVQAFTDHKIRKT
YIALCIGSAPKWENISIKSGHGRSKFGVWRVYAASDVGRTLPGGSTVRAMATTFQVLSVN
RQGKFIEPTKSRPNEEEYVVIEDKGVVCGDGNDEVIVRAYPRSGRTHQIRLHCQYLGIPI
RGDVKYEGFNEWKGETFDGHSLHAETLLFDHPVTGLEVELRAPLPLWASQALQPEGSVIT
ESMSSLHSSGRS
Download sequence
Identical sequences A0A2G5C209
Aquca_118_00014.1|PACid:22042547 Aquca_118_00014.2|PACid:22042548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]