SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_166_00005.1|PACid:22051632 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_166_00005.1|PACid:22051632
Domain Number 1 Region: 87-354,426-514
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.35e-39
Family WD40-repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 493-691
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 0.0000000000000194
Family Nitrous oxide reductase, N-terminal domain 0.034
Further Details:      
 
Domain Number 3 Region: 19-114
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000439
Family WD40-repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_166_00005.1|PACid:22051632
Sequence length 706
Sequence
MGQSHNSAFSTDDLPKTVARTFSQGSSPMSMDFHPRQQTLLLVGTNVGDIALWEVGSRER
LFLRNFKVWDLGACSMPLQASLVKDPSVVVNRIIWNPDGSLFGVAYSRHIVQIYAYHGGD
DVRQHLEIDAHVGGVNDLAFSHPNKQLCVVTCGDDKTIKVWDAATGAKQYTFEGHEAPVY
SVCPHYKENIQFIFSTALDGKIKAWLYDNLGSRVDYDAPGHWCTTMAYSADGSRLFSCGT
SKDGESYIVEWNESEGAVKRTYLGFRKRSAGVVQFDTTKNRFLAAGDEFVIKIWDMDNVN
LLTTMDAEGGLPASPRIRFNKEGTLLAVSANDNAIKVLATTDGLRLLRTFENRSFDASRA
ASEAVSKPSINPISAAAAAAATSAGHADIGASVVSISGMQMTSQKFGNSLISDGAQCRTM
RLPDSIRSSKISRLIYTNTGTAILGLASNAVHFLWKWQRNERNSSGKATANVPPTLWQPS
SGILMTNDIADVNPEECVPCFALSKNDSYVISASGGKISLFNMMTFKFSSGADAQICVWN
SDGWEKQKSRFLQIPAGRNPAALSDTRVQFRQDHMQFLVVHETQLAIYETTKLECLKQWV
PRESSAPISHATLSCDSQLVYASFLDATVCIFGAANLRLRCRINPTAYLPANVSASIHPL
VIAAHPQEPNQFALGLTDGGVHVFEPLESEGKWVDHLYKKWRRIQR
Download sequence
Identical sequences A0A2G5C0T7
Aquca_166_00005.1|PACid:22051632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]