SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_266_00001.1|PACid:22055091 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_266_00001.1|PACid:22055091
Domain Number 1 Region: 13-331
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 2.94e-75
Family Catechol oxidase 0.000000597
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_266_00001.1|PACid:22055091
Sequence length 500
Sequence
MYFLNLFIISNYLFSFRTKKVYCCPPYSSADIKPFVPPNDSILRKRKPAHKLNRKEIEDF
KRGIQLMKELPETDPWSYYQQATIHCTYCNGAFDQVGFEDVLLQIHGSWLFTPWHRYYIY
FWEKILGKLLKDPTFAIPYWSWDTPEGMYMPGMYLDRNSPLYDDNRNHNHFTALMDYDFT
WGAPNPTPEQEEEVKIRNLKKIHNMFTETIGAPSLFLGGPLSAGQVPQDIAGALENQHGL
PHQWTGPEAIPYHDMGNFYTAARDTIFFGHHANVDRLWDIYSDLRGNKVEFDNPDWLDAS
FIFYDENRQMVNCKVRDCLITENLGYTYTTEQHAWKDIKRTYKKLQRGKKRSAGEGLSLI
PVSEFGSTPRALNSTIRVLVPRPKVSRSTDEKEEFSEVVVVEGIKFGHGESTKFDVYIAK
PIEGLVGPDLGELAGSFVRVTHTHHKKDKVETTSKIELGVTNLLDDIEAEASDSLVVSLV
PQHGDVTIGGVRIDLFASDI
Download sequence
Identical sequences A0A2G5C0J9
Aquca_266_00001.1|PACid:22055091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]