SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_521_00002.1|PACid:22054154 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_521_00002.1|PACid:22054154
Domain Number - Region: 17-58
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0369
Family Quinoprotein alcohol dehydrogenase-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_521_00002.1|PACid:22054154
Sequence length 241
Sequence
MQDKGAHWDPKDEWEHSRSLALNDDDDDDGTQLMSSGGDGHIYHCDLRTITCFHKNPNVA
MVELKKPVGQGTRQLQNKGEKSHETIQVLRNCNSPLRSIDLKDVVTYEEFVNHFTHEEQL
QLMKYLPSVDTFRLPESLKSMFDSLLFAENLSSFQKLLAEGVFDRSLSEVDADEFKTLKK
LALVNLTKSNWIEHYNLLKDVKNKQKTGAKELATGSKMLHVKRPRNGQNPQGRPSVVLCM
S
Download sequence
Identical sequences A0A2G5C0E4
Aquca_521_00002.1|PACid:22054154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]