SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_001_00015.1|PACid:22042933 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_001_00015.1|PACid:22042933
Domain Number 1 Region: 88-183
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-22
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 250-305
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000244
Family SAM (sterile alpha motif) domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_001_00015.1|PACid:22042933
Sequence length 312
Sequence
MKQQVEFLSKFQYHGMDFEYEKKPRRTVKEEGKLPGTNGMYFKHFTAVEKKNKKPQIFTA
KAEMEDIVEVIDLEEDEEDVTMEADQVYPKFVAEMKDSNVGYPFQLNVPIAFSRLNLPCF
STDITIQNLKGNIWKIRFYCDSGMHMFTNGWKVFALDNALRKGDHCEFELVDECKMLCQI
FRVDRPKRSLEDSENTSTTRGWTIYEESTTKRDLSPKNKNKKARTLAPEVTDTSSCVDKL
KSTRHVSDQVDSVDSFLESMGLEKYLSTFKAEEIDMTALKFMDEDDFKSLCIPMGPRKKI
LAALDSKAKALS
Download sequence
Identical sequences A0A2G5F899
Aquca_001_00015.1|PACid:22042933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]