SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_001_00030.3|PACid:22043182 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_001_00030.3|PACid:22043182
Domain Number 1 Region: 41-97
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000523
Family F-box domain 0.0035
Further Details:      
 
Domain Number 2 Region: 169-321
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0000654
Family Galactose oxidase, central domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_001_00030.3|PACid:22043182
Sequence length 426
Sequence
MKNLKKRKPFPFRFLLNRILSSKRSSFNREEMKKKMKKLKKVESFCWFNLLPEELTLNIF
SRLPIKSLMKSKCVCKTWNSSISNPHFINQHLSRSPFIGNPFIIFSTTDFIIDDNPNYPK
PKLSIRRNFHFVEDIGGENEEVKPLALDPVLTYLDIVGSVNGLLCFGGTSCNGDLITVYV
FNPFTGESTQLPTLSSIPFESKHTLFGFGFDSDRGEYKVLRLIFHSMKECLADCIVEAEV
CTLGSNSWRRIGEAPFSPYGSEACVFANGMIHCVANSIDDGDDIGIGYFDVGTEELYFDS
LFPEMLPVWDENIDIGVLGGCLSVVNYSSLDFAEVWIYTDFFQKGENKEEAWTRLFQLPL
DNVVSLNLMCLLKSGEILFLHNHEELVSRYPFGNDPRELGLHGMSETIHAYVHVGTLVSP
IMPPQS
Download sequence
Identical sequences A0A2G5F8G3
Aquca_001_00030.1|PACid:22043183 Aquca_001_00030.2|PACid:22043184 Aquca_001_00030.3|PACid:22043182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]