SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_001_00307.1|PACid:22042911 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_001_00307.1|PACid:22042911
Domain Number 1 Region: 8-286
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.57e-48
Family WD40-repeat 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_001_00307.1|PACid:22042911
Sequence length 301
Sequence
MPGQKIETGHQDTVHDVVMDYYGKRIATASSDSTIKIVGVSNSGSQHLATLSGHQGPVWE
VAWAHPKFGSLLASCSYDGSVIIWKEGNQNEWSQAHVFSDHKSSVNSICWAPHELGLSLA
CGSSDGNISVYTARAEGDWETTRIVDAHLVGVTSVSWAPAMAPGALVGKDLLDPVQKLVS
GGCDSTVKVWKLYNGTWKMDCFPALHMHTDWVRDVSWAPNLGLPKSTIASASQDGKVIVW
TVAKEGDQWQGKVLQDFKTPVWRVSWSLTGNILAVADGNNNVTLWKEAVDGEWQQVTTVE
P
Download sequence
Identical sequences A0A2G5F9R8
Aquca_001_00307.1|PACid:22042911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]