SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_001_00601.1|PACid:22044268 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_001_00601.1|PACid:22044268
Domain Number 1 Region: 215-319
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000155
Family B3 DNA binding domain 0.0044
Further Details:      
 
Domain Number 2 Region: 26-113
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000255
Family B3 DNA binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_001_00601.1|PACid:22044268
Sequence length 321
Sequence
MAELKLKQKGDNPSPSIVRMKRNKFFRVIKSRYPQIEFPSEFVEEHGYKLPDELVLKVRT
GDFWNIKVKKFGERIRTLRGWQGFVEHYSIGVGYCLFFTYDGISSFDVVICDAEDAEIDY
PLKPHKFKNTIHGGAKLGESTNKECVKNSTKNLGMTSPREDTHQRTEHGEPSVYRANEDM
APEDVPAPKQVSCDTPAVSPSQTNADGVGQRTGSFNSKYPFFKITMGRSYINQASVSIPK
SFTVSHLPHVQGLGSLSFTLQLSDQGKKWHVECNHCHRGVWRITKGFFPFIRESNIKIVD
ICVFELINKENILFNVHILSC
Download sequence
Identical sequences A0A2G5FBF3
Aquca_001_00601.1|PACid:22044268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]