SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_001_00900.1|PACid:22043661 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_001_00900.1|PACid:22043661
Domain Number 1 Region: 52-159
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000186
Family B3 DNA binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_001_00900.1|PACid:22043661
Sequence length 165
Sequence
MTTSTVFFDFMPSKEEEEKGVASGEFPLTPIRAQRVEIRNTPPRLLDLLTPWECRKIMTA
SDVGHLGALVLGIEHIQRHWGLDWTAINRGTQVAVIIRDVETRTDHNLLLRKTHDDAFLL
HNNWLRDFVFRRNLKEGDTIGMYWNRTSSSICFSVLKRAIGMRRE
Download sequence
Identical sequences A0A2G5EZE4
Aquca_001_00900.1|PACid:22043661 Aquca_003_00503.1|PACid:22050311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]