SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_00059.3|PACid:22052321 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_00059.3|PACid:22052321
Domain Number 1 Region: 841-1036,1106-1149
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.06e-39
Family Pyruvate phosphate dikinase, N-terminal domain 0.025
Further Details:      
 
Weak hits

Sequence:  Aquca_002_00059.3|PACid:22052321
Domain Number - Region: 697-774
Classification Level Classification E-value
Superfamily Phosphohistidine domain 0.0837
Family Pyruvate phosphate dikinase, central domain 0.084
Further Details:      
 
Domain Number - Region: 549-686
Classification Level Classification E-value
Superfamily ARM repeat 0.0921
Family MIF4G domain-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_00059.3|PACid:22052321
Sequence length 1150
Sequence
MDLFYKQMEFEEARKELQMELEKGSSLEDIRKKITKGNKQTKVSEQAPKRYSTPKRIQRR
QRDVMTLLNKYAAESIEEKPSVISRVSSPIELFLKAKEEQGCGSILNKQIFKLGEKKILA
LVTEAIGKKKVHLATDLGGPLTLHWALSKNVGEWQAPPSSVAPKGSVMLERASETPFADS
SSSDPPYQVQSLEIEIGEENYVGMPFVLRSGENWIKNGGSDFYVNFSNAAKKVKKDVGDG
NGTAKALLEKIAEMESEAQKSFMHRFNIAADLMGWAKDSGELGLAGILVWMRFMATRQLI
WNKNYNVKPREISKAQERLTDLLQDIYKTHPQHRELLRMIMSTVGRGGEGDVGQRIRDEI
LVIQRNNDCKGGMMEEWHQKLHNNTSPDDVVICQALIDHIKSDFDMSVYWKTLNSNGITK
ERLLSYDRAIHSEPNLRRDQKDGLLRDLGNYLRTLKAVHSGADLESAIANCMGYKAEGQG
FMVGVSINPISGLPGGFPELLQFVLDHVEDKNVEPLLEGLLEAREELRPLLLKPHDRLRD
LLFLDIALDSTVRTAIERGYEELNNAGSEKIMSFITLALENLALSSDNNEDLIYCLKGWD
LAQKMCKRGDDQWALYAKSVLDRTRLALASKAEHYDKVLQPSAEYLGSLLDVDQWAVNIF
TEEIIRAGSAASLSSLLNRLDPVLRKTANLGSWQVISPIEAVGYVVVVDELLTVQNMTYE
KPTILVAKSVKGEEEIPDGAVAVLTPDMPDVLSHVSVRARNSKVCFATCFDPNILNDLKE
KEGKLLQLKPTSADIVYSELKDGELLGGSSTTLRDDDSPSLTLVKKQFCGRYAISSEEFT
NEMVGAKSRNISYLKGKVPSWVGIPTSVALPFGVFEKVLSDDSNQKVAATLLSLKRKLGE
GDFNALGEIRQTVLQLAAPPQLVKELKSTMQGSGMPWPGDEGEKRWEQAWTAIKKVWASK
WNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSSGDSSEIYAEVVKGLGE
TLVGAYPGRALSFISKKNDLNSPKVLGYPSKPIGLFIRRSIIFRSDSNGEDLEGYAGAGL
YDSVPMDEEEKVVLDYSTDPLMTDSKFRHSILSSIAGAGKAIEDLYGSPQDIEGVVRDGK
IFVVQTRPQM
Download sequence
Identical sequences A0A2G5F1F2
Aquca_002_00059.3|PACid:22052321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]