SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_00129.1|PACid:22051860 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_00129.1|PACid:22051860
Domain Number 1 Region: 57-107
Classification Level Classification E-value
Superfamily F-box domain 0.000000942
Family F-box domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_00129.1|PACid:22051860
Sequence length 310
Sequence
MVQKKVKRGYSYGEEDQENQSICSFHILSDTVVHKKAKKEYCDELKLSLMKCPSEIIFGH
ILPSLPIEGLIQCTSLCKNWYKLIKQPVFMDMQLQKAMYQPRRILLVPIPLMADINFPRM
RDIQKLPRMRDIKKLPTKYLVLVDKVEGKWKGRVIPVTNSKRNSVYAWTHNFTIVDTCNG
LLCLTSPCSITIYNPITRECVNIAKSEENHSDRFYVYGFGFDIVSKKYKVVQVSIKMCRG
YQSSGNIGDIIKGEIITLGEGSWRKLVFPCLIKADDRSKPVLLDGAFHWIIDKLSHSSGL
ERNSCIRHCN
Download sequence
Identical sequences A0A2G5F1Q5
Aquca_002_00129.1|PACid:22051860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]