SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_00696.1|PACid:22053443 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_00696.1|PACid:22053443
Domain Number 1 Region: 152-432
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-78
Family Protein kinases, catalytic subunit 0.0000212
Further Details:      
 
Domain Number 2 Region: 39-132
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.02e-19
Family Ankyrin repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_00696.1|PACid:22053443
Sequence length 436
Sequence
MEGGNSDESGGSGSGSSTTNSVEISKQKEKSRVSRTSLILWHAHQNDSNAVKKLLEEDKS
LVHARDYDNRTPLHVASLHGWIDVAQCLIDYGADVNAQDRWKNTPLADAEGAKKKNMVEL
LKTYGGLSYGQNGSHFEPKPVAPPLPNKCDWEIEPSELDFSTSVIIGKGSFGEILRACWR
GTPVAVKRILPSLSDDRLVIQDFRHEVNLLVKLRHPNIVQFLGAVTERKPLMLITEYLRG
GDLHQHLKEKGSLNPATAINFALDIARGMTYLHNEPNVIIHRDLKPRNVLLVNTSADHLK
VGDFGLSKLIRVQNSHDVYKMTGETGSYRYMAPEVFKHRKYDKKVDVFSFAMILYEMLEG
DPPMASYEPYEAAKYVAEGHRPVFRAKGYIPELRVLTEQCWAADMNQRPSFLEILKKLEK
IKDNLPSDHHWNLFTT
Download sequence
Identical sequences A0A2G5F4H7
Aquca_002_00696.1|PACid:22053443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]