SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_01243.1|PACid:22051843 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_01243.1|PACid:22051843
Domain Number 1 Region: 52-100,142-189
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000089
Family F-box domain 0.0062
Further Details:      
 
Weak hits

Sequence:  Aquca_002_01243.1|PACid:22051843
Domain Number - Region: 93-248,277-320
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00714
Family Quinohemoprotein amine dehydrogenase B chain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_01243.1|PACid:22051843
Sequence length 391
Sequence
MELLKNLWLWGICLRRKRESSLKSRLSNADTEHAVTTNPTTTTSSSIITIDTYIPCDILV
EILINLPARSLVRFKYVCKIWFSLIDDPSFVNRHLALAKEKGKGILQMSDSSLYSLDASS
CLVKELLPITLQDTSSAGLVKGLKNIYRYSLSSCNRFSLSSCNGLFCFPERYSDFIRVFN
PITGETITIPKPSRITSIYMSALCFDMSSRNYNVVCYTDYTHGLQVFTLGIERSSWKCIK
WPSNFDEFPWFNKAVSVNGALHWGYTNICHREKGFLQCRIIAFNLASENFTLIFCPNVTQ
YLYKVCESGGSLAVIETPTMTIMGELNVWVLRDYHKQEWVKQLWGTRDDIIFRQGTLNCE
KLIFKDFVLMLLESLGGFFEIQQQHLARRKG
Download sequence
Identical sequences A0A2G5F785
Aquca_002_01243.1|PACid:22051843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]