SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_01359.1|PACid:22052490 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_01359.1|PACid:22052490
Domain Number 1 Region: 262-645
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.57e-91
Family Regulator of chromosome condensation RCC1 0.00044
Further Details:      
 
Domain Number 2 Region: 15-122
Classification Level Classification E-value
Superfamily PH domain-like 3.93e-21
Family Pleckstrin-homology domain (PH domain) 0.0061
Further Details:      
 
Domain Number 3 Region: 649-717
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000035
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0042
Further Details:      
 
Weak hits

Sequence:  Aquca_002_01359.1|PACid:22052490
Domain Number - Region: 831-874
Classification Level Classification E-value
Superfamily Prefoldin 0.0575
Family Prefoldin 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_01359.1|PACid:22052490
Sequence length 1080
Sequence
MGEDSLASTPSDRRVEQAILALKKGAQLLKYRPRGKPKFCPFRLSTDERHLIWYSGTDEK
QLRLDSITKIIPGTVNFQRQPEPGKECQSFSIIYAYGERSLDLVCKDKVQAESWLVGLRA
LVSRSYLNKPFATLKSWGGAKSCINSPVGYSRRKHNLGLSEDPTKYSQVRSLCGSPPRLL
AERYLSDGLSCSSDSFHSSRTRAFSHIQTVRDVVTPHLSSLESDDFEKAERFVSECQTPI
RHEVWPANPGLPVVEKTNVLRDVLMWGEGMEGGKLRGGDRICAPNDAQLDALLPKLLESI
ELLDVKNISFGGKHAALVTRQGEVFCWGEENGGRLGHKINLDLSHPKLVESLNAVHVESV
SCGEYHTCAVTYDGELYTWGRVGADVGDLRNKCQWLPHKLSGPFDSIHVSSVACGEWHTA
VVASSGQLFTYGDGTFGVLGHGNVQSISQPKEVESLKGLRVKSVACGPWHTAAVVDIMVD
RSIGNASSGKLFTWGDGDKGKLGHVDRETKLLPTCVARLVEHDFVQVSCGRMLTVGLTST
GLVCTIGSAIHGQLGNPLAEDKSIAIVEGSLKGEFVKSISSGSYHIAALTSSGRVYTWGK
GANGRLGLGDIQDRSSPTLVEALRDRHVESVACGSSFSAAICLHKSILSSDQTACSGCKM
VFGFTRKKRNCYNCGFLFCRACSSKKVMNASLAPNKSKPCHVCDMCFNRLTKLTNSPIDY
EDKQSLVLANAFPDLKIERGEATLARGSLISPKMSNHEDKKIIGGKTLDKVWKNQQPLDH
AFPLSSRPRWGQVQCPVLFSTGTLSKSEPVAEQHLSPGPNNKVPRLTSFLEDFSEPDKML
TEEVQRLQLEAKSLERQCQVKRERLQQYQQRIEQTWSLAKDEAAKCKTAKEIIKALTIKL
YTLSEKHSTLNDANIITTQAEGLGLNMYLPEITPICTDASVLDDVDPMLFTARLSAATPN
HRQGNEVCALPIPLREPMSNTFTRDQYNVSSRLSDESLVPESCSEQHVAKTLKSDWVVQD
EPGVYITFTTMPNGQKGLKRVRFSRKRFSEKEAERWWEENQQRVYEKHDIEGIMNPNKKK
Download sequence
Identical sequences A0A2G5F7L8
Aquca_002_01359.1|PACid:22052490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]