SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00026.2|PACid:22049979 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00026.2|PACid:22049979
Domain Number 1 Region: 16-251
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.81e-49
Family Ankyrin repeat 0.00047
Further Details:      
 
Domain Number 2 Region: 317-378
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000462
Family RING finger domain, C3HC4 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00026.2|PACid:22049979
Sequence length 446
Sequence
MGQGLSCRGSIEHQDLFSSVQVGDLDNFEALLERDPSLLHQSSIYDRLSALHIAAANGQI
EVLCMILDRSVNPDILNRHRQTPLMLAAMHGRLACVLRLLQAGANILMFDSVQGRTCLHY
AAYYGHSDCLQAILDAAHSSPVADSWGFVRFVNVRDGNGATPLHLAARQRRSECVHMLLD
SGALVCASTGGYGCPGSTSLHLAARGGSLDCIRALLAWGADRLQRDSSGRIPYVVALKYN
HGRCAALLNPSSAEPLVWPSPLKFISELNQEAKVLLERALMEANMEREKNILKGTSHSQL
PSPSHSDSGVEDNISEASDSELCSICFDQVCTIEVQDCGHQMCAPCTLALCCHNKPNPTT
ASITSPVCPFCRSNIAQLVVVKTKNNDQDIDKDLSSSKLRKSRRSRNYSEGSSSFKGLST
MGSFGKMGGRVSGKVAAECSDWVDKP
Download sequence
Identical sequences A0A2G5EWY3
Aquca_003_00026.2|PACid:22049979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]