SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00206.3|PACid:22050608 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00206.3|PACid:22050608
Domain Number 1 Region: 9-56
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000288
Family F-box domain 0.0069
Further Details:      
 
Domain Number 2 Region: 101-296
Classification Level Classification E-value
Superfamily L domain-like 0.000000299
Family Internalin LRR domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00206.3|PACid:22050608
Sequence length 302
Sequence
MKKCCSNQNPDRISYLPDPVRSHIVSFLPMRDAIRTSILSKQWRHIYYSLSRLEFDQYDF
TKIKHKAADFRDFVDRIVICHDGSDIQKFSLKTRLDDEFISSSRVRTWVSFALQHNVQEL
EMWMYYGKITNLPFRFFTCMTLRVLSLVSVEIEWPTTVRFPVLKYLYVEDLSFDQYENTI
DKLFSSCTCPMLEDLVLRQCDLGVSTLSICNPSLKYLQIFDGNQLNINISVSTLHKLECI
WCLPPNISSETLSSLSDAYFELSDSDLRGTAVVASQFNSVSKILLGLHNVKTLELDSTFI
EV
Download sequence
Identical sequences A0A2G5EXV3
Aquca_003_00206.3|PACid:22050608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]